PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 166aa    MW: 19230.3 Da    PI: 8.6307
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1259genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.3e-1248105562
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  k+ +r+ +NRe+ArrsR +K++ +e L ++v +L++ N++  ++++  ++   k++++
  Gh_D12G1259  48 KKRKRMLSNRESARRSRMKKQKLLEDLVNEVSALQKNNTQICEKIKFTTQRFVKMEAS 105
                  899***************************************9999888777777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-1244108IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-946128No hitNo description
PROSITE profilePS502179.9946109IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.98E-114899No hitNo description
PfamPF001701.9E-94893IPR004827Basic-leucine zipper domain
CDDcd147021.35E-184999No hitNo description
PROSITE patternPS0003605166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MSFAIPMHRI HILHSFSVVF LYWFYMATVQ KPACSSDSDP RYANIDEKKR KRMLSNRESA  60
RRSRMKKQKL LEDLVNEVSA LQKNNTQICE KIKFTTQRFV KMEASNSVLR AQVIELTESL  120
QSLNSMLHMV EDISGYDVDI PEIPDPLMKP WQLPCATQPI CSTFDG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.149350.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5268078e-33HQ526807.1 Gossypium herbaceum clone NBRI_B_2935 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437973.14e-99PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP81e-52BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A0D2RF191e-120A0A0D2RF19_G
STRINGPOPTR_0002s19720.19e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.18e-54basic region/leucine zipper motif 53